PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G2448
Common NamebZIP15
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 321aa    MW: 35936.4 Da    PI: 8.395
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G2448genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.83.7e-16251300555
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                  +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++L+ + +el k+
  Gh_A05G2448 251 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENERLR-KQKELDKM 300
                  79****************************************.55666666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.5E-15243294No hitNo description
SMARTSM003385.2E-13247319IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.76249294IPR004827Basic-leucine zipper domain
CDDcd147073.39E-24251305No hitNo description
PfamPF001701.7E-13251295IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.88E-11251296No hitNo description
PROSITE patternPS000360254269IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGIQTMGSQG DGGSNGKQLQ CQPITRQNSM YSLTLDEVQN QLGDLGKPLN SMNLDELLKN  60
VWTLEANQTL GTETEGTAVT NQTSLQRQAS SSLTSALSKK TVDEVWKDIQ QNKIDGEKKS  120
RERQPTLGEM TLEDFLVKAG VVNEASNDEN ARPIAGVDLS VAPQFAQQGQ WMQYPQQPQY  180
HHPQQSIMRV YMPGQPMPQP LAIGTTGVMD VSYPENQLAL PSPLMGTLSD TQTSGRKRGA  240
HEDVVEKTVE RRQKRMIKNR ESAARSRARK QAYTNELENK VSRLEEENER LRKQKELDKM  300
LPSAPPPEPK YQLRRTSSAP F
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.205100.0boll
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP9382990.0KP938299.1 Gossypium hirsutum strain KK1543 bZIP transcription factor (bZIP15) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447410.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
SwissprotQ9LES31e-102AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A0K2JKR50.0A0A0K2JKR5_G
STRINGPOPTR_0008s01130.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM18842883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.18e-89ABA-responsive element binding protein 3